Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Prostaglandin D2 receptor (PTGDR)

This Recombinant Bovine Prostaglandin D2 receptor (PTGDR) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Prostaglandin D2 receptor, PGD receptor, PGD2 receptor, Prostanoid DP receptor

UniProt

A5D7K8

Expression Region

1-361

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST LQLLAMALECWLSLGHPFFHRRHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG TWCFFQMVHEERSLSVLSYSVLYASLMLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS RERAEPGAGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIYRNWHSNSCQTNMESS L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-500 1x 500 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (C4/206), CF568 conjugate, 0.1mg/mL
BNC680206-500 1x 500 µL

CD4 (C4/206), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF740 conjugate, 0.1mg/mL
BNC740461-500 1x 500 µL

Chromogranin A (PHE5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details