Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-32 (sre-32)

This Recombinant Serpentine receptor class epsilon-32 (sre-32) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-32, Protein sre-32

UniProt

P90837

Expression Region

1-361

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIKILDPSKNATYLWLPVYFYDEPFQFQILSSIIELVFYISCFHLMTISLYVMLKVQIF HRNLYILYIPMFCVWYGLIAGKLITIAYRLKFVDLDYELGEHIAMWTDDQAKMLHVSSLR GLELLIFGGFVQWHYMYTVVYGILGVAAERAIASVLIENYETNTQLYIPIALTIITQFLA ISTSLSVLFHKASVFLSHLPWIISCSLGALAYLFIKIVNENFQKQITNPRRKRLFTISQQ FQVKENLRALRLGTRLVFVVFFYVAFVSFGMFALAFDLVSSAYCHFVENFLFLNPYPICF TAMLTIPHWRKHFQNACFTWRLVKSAWTKPKTSTTSVEISTTKKLEAETDLYFRQLNESW I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/iFluor® 750 Anti-human CD4 Antibody *HIT4a*
100401G2-AAT 500 Tests

APC/iFluor® 750 Anti-human CD4 Antibody *HIT4a*

Sign In for Pricing
View Details
PHKA1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2414418 100 µL

PHKA1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Anti-Mouse IgG (H+L) - 70nm Gold NanoUrchins
GUAC-70-02-10 0.5 mL

Anti-Mouse IgG (H+L) - 70nm Gold NanoUrchins

Sign In for Pricing
View Details
Donkey Protein FAM162B (FAM162B) ELISA Kit
MBS9930139 Inquire

Donkey Protein FAM162B (FAM162B) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal CD7 Antibody (3A1E) [Alexa Fluor 350]
NBP2-81050AF350 0.1 mL

Rabbit Monoclonal CD7 Antibody (3A1E) [Alexa Fluor 350]

Sign In for Pricing
View Details
APBA1 Protein Vector (Human) (pPB-His-MBP)
PV322638 500 ng

APBA1 Protein Vector (Human) (pPB-His-MBP)

Sign In for Pricing
View Details