Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D Chitin synthase export chaperone (CHS7)

This Recombinant Cryptococcus neoformans var. neoformans serotype D Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

P0CM73

Expression Region

1-361

Origin

Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) (Filobasidiella neoformans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDNAAFKFGSFDYICEHAALVVCPMLGDQQGMAPTCYSRNVQLGSQIIFQPATCILHIA ALVMATIMLLHVRSKYTAVGRKEIVLFFYMYIWVELFAIFLDSAIIPTANKVYPWFAAIY AGSVGALYWCLLLNGFVGFQFHEDGTPMSLWFLRISSLVVGAVCFGIPVATFKGTSSSMS PTNTVGLFITYLVFPCVCVLIYFISQMLLVVRTLDDRWVIGDLVFMAGFYIAGVLLLVTF SVTICDAVKHYVDGVFFSTLAFLFAVMMVYKYWDSITKEDLEFSVGSKQAVWDVKDPLLA TGMEYYEDDAQSAYRGAGGSLVGGYNGNQYYGNQPGYAQSAYGQQGYGQYGAGGGYGQGH Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC691238 3'UTR Luciferase Stable Cell Line
TU212302 1.0 mL

LOC691238 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Talin-1 Protein, GST, E.coli-500ug
QP8498-ec-500ug 500ug

Recombinant Human Talin-1 Protein, GST, E.coli-500ug

Sign In for Pricing
View Details
Cnn1 siRNA Oligos set (Mouse)
16464174 3x 5 nmol

Cnn1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
MDFI siRNA (Human)
orb1865410-01 15 nmol

MDFI siRNA (Human)

Sign In for Pricing
View Details
MDFI siRNA (Human)
orb1865410-02 30 nmol

MDFI siRNA (Human)

Sign In for Pricing
View Details
Rat Ankh Pre-designed siRNA Set A
SI200618A 1 Each

Rat Ankh Pre-designed siRNA Set A

Sign In for Pricing
View Details