Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class X 45 (srx-45)

This Recombinant Serpentine receptor class X 45 (srx-45) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Serpentine receptor class X 45, Protein srx-45

UniProt

P34490

Expression Region

1-361

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQILMENVEVQHIDRIAALLIFFTSFIGFACNTFIAFYIRRLSLLRNSFGRLLQLQAAG DAVFVLVWAFYFAPVLFFDIKPLQSLAIAARFAQLCLICYDISIYTHLVISLNRFISLYF PTSYQNIFTERFTTFLICSIIFVSFGFSWFLVIRDCQMGFSIPRWMLDYVSPPCEMINVY YAEFFRGLIVISMFAITNSFTFCRMHMHNRKKQTATVFETTQQKKRRAVETRFVQQVTMQ GLLYVIELVTYFYISLRFPVPLEPVELAKSSNRWPNFLLTTYAWILVHALDGVITLIFNK QFRSVLRHPCRSQEALNISKTPSRRSRFTTNRDESNRKKSSILACTFISNSNTGYGSSVH V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha A Crystallin (CRYAA) Human Gene Knockout Kit (CRISPR)
KN216946 1 Kit

alpha A Crystallin (CRYAA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Calcium Sensing Receptor (CASR) Human Gene Knockout Kit (CRISPR)
KN211229 1 Kit

Calcium Sensing Receptor (CASR) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL
BNC471725-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-01 20 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details