Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class X 45 (srx-45)

This Recombinant Serpentine receptor class X 45 (srx-45) spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Serpentine receptor class X 45, Protein srx-45

UniProt

P34490

Expression Region

1-361

Origin

Caenorhabditis elegans

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQILMENVEVQHIDRIAALLIFFTSFIGFACNTFIAFYIRRLSLLRNSFGRLLQLQAAG DAVFVLVWAFYFAPVLFFDIKPLQSLAIAARFAQLCLICYDISIYTHLVISLNRFISLYF PTSYQNIFTERFTTFLICSIIFVSFGFSWFLVIRDCQMGFSIPRWMLDYVSPPCEMINVY YAEFFRGLIVISMFAITNSFTFCRMHMHNRKKQTATVFETTQQKKRRAVETRFVQQVTMQ GLLYVIELVTYFYISLRFPVPLEPVELAKSSNRWPNFLLTTYAWILVHALDGVITLIFNK QFRSVLRHPCRSQEALNISKTPSRRSRFTTNRDESNRKKSSILACTFISNSNTGYGSSVH V

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGAL (LCN2) (NM_005564) Human Recombinant Protein
TP307685 20 µg

NGAL (LCN2) (NM_005564) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (C-10His)
PKSV030278-01 50 µg

Recombinant SARS-CoV-2 S1 Protein (C-10His)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S1 Protein (C-10His)
PKSV030278-02 500 µg

Recombinant SARS-CoV-2 S1 Protein (C-10His)

Sign In for Pricing
View Details
MAG Recombinant Chimeric Antibody Antibody
HA610254 100 µg

MAG Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
Klhl32 Mouse Gene Knockout Kit (CRISPR)
KN308871LP 1 Kit

Klhl32 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EWSR1 (NM_005243) Human Recombinant Protein
TP303709M 100 µg

EWSR1 (NM_005243) Human Recombinant Protein

Sign In for Pricing
View Details