Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Blue-sensitive opsin

This Recombinant Chicken Blue-sensitive opsin spans the amino acid sequence from region 1-361.

Product Specifications

Product Name Alternative

Blue-sensitive opsin, Blue cone photoreceptor pigment

UniProt

P28682

Expression Region

1-361

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHPPRPTTDLPEDFYIPMALDAPNITALSPFLVPQTHLGSPGLFRAMAAFMFLLIALGVP INTLTIFCTARFRKLRSHLNYILVNLALANLLVILVGSTTACYSFSQMYFALGPTACKIE GFAATLGGMVSLWSLAVVAFERFLVICKPLGNFTFRGSHAVLGCVATWVLGFVASAPPLF GWSRYIPEGLQCSCGPDWYTTDNKWHNESYVLFLFTFCFGVPLAIIVFSYGRLLITLRAV ARQQEQSATTQKADREVTKMVVVMVLGFLVCWAPYTAFALWVVTHRGRSFEVGLASIPSV FSKSSTVYNPVIYVLMNKQFRSCMLKLLFCGRSPFGDDEDVSGSSQATQVSSVSSSHVAP A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-01 0.01 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details
Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-02 0.1 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details
Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-03 0.25 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details
Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-04 0.5 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details
Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-05 1 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details
Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)
MBS9422955-06 5x 1 mg

Recombinant Mouse C-X-C motif chemokine 3 protein (Cxcl3)

Sign In for Pricing
View Details