Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-2 (srd-2)

This Recombinant Serpentine receptor class delta-2 (srd-2) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-2, Protein srd-2

UniProt

Q21767

Expression Region

1-362

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNTIQNSTITDDLKYVMTLDKLTEYLSCLICLPGALCNAILIYLIWKRTPIQMRSYAIY ILNFALFDFATCIISFFSCQQVIFSDFSLVYIFHGPCKYVSPWFCYFCHCFMCHALAHSQ WILLGSFIYRYRVLTGETPTAKDLIRNSVALYSMSLCFLLVYVFDNSDSDLLFQILTRVH PEYHYDDESIWKKSIVVSGNISAFAPITLISILYMTIPCVPIYCAILYFRHNTRVILNNP HINLSPTAKSNHVKLIRALTVQAGIPIFWLVASGIFTMSQFGIIGGPIPENITFRLMDCI PLISPIVTIIFVQPYREGLLKVLLKNSGLFVPNIIGSSIVDQTVAVTSVFGPKVTAFVQT QL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Nitrobenzeneethanesulfonic Acid
TRC-N493280-2.5G 2.5 g

4-Nitrobenzeneethanesulfonic Acid

Sign In for Pricing
View Details
Human PAF1 activation kit by CRISPRa
GA110203 1 Kit

Human PAF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Ibogaine Hydrochloride
TRC-I123000-5MG 5 mg

Ibogaine Hydrochloride

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3231), CF568 conjugate, 0.1mg/mL
BNC683231-500 1x 500 µL

Prohibitin (Mitochondrial Marker) (PHB/3231), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EBP50 (SLC9A3R1) Human Gene Knockout Kit (CRISPR)
KN201653RB 1 Kit

EBP50 (SLC9A3R1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human SH2D1B activation kit by CRISPRa
GA114630 1 Kit

Human SH2D1B activation kit by CRISPRa

Sign In for Pricing
View Details