Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Apelin receptor A (aplnra)

This Recombinant Danio rerio Apelin receptor A (aplnra) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Apelin receptor A, Angiotensin II receptor-like 1a, Angiotensin receptor-like 1a, G-protein coupled receptor APJ A

UniProt

Q7SZP9

Expression Region

1-362

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPTSEYTETYDYYDTGYNDSGCDYSEWEPSYSLIPVLYMLIFILGLSGNGVVIFTVWRA KSKRRAADVYIGNLALADLTFVITLPLWAVYTALGYHWPFGVALCKISSYVVLVNMYASV FCLTCLSFDRYLAIVHSLSSGRLRSRATMLASLGAIWFLSCLLAVPTLLFRTTVDDTGSN RTTCAMDFSLVTLNQDHESLWIAGLSLSSSALGFLLPFLAMTVCYCFIGCTVTRHFSHLR KEDQKKRRLLKIITTLVVVFAFCWTPFHVLKSMDALSYLDLAPNSCGFLHFLLLAHPYAT CLAYVNSCLNPFLYAFFDLRFRSQCLCLLNLKKAMHGHMSSMSSTLSAQTQKSEVQSLAT KV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL
BNC741045-100 1x 100 µL

CD16 (C16/1045), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL
BNC472419-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2419), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL
BNC402563-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL
BNC401485-500 1x 500 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF640R conjugate, 0.1mg/mL
BNC402366-500 1x 500 µL

CD269 / TNFRSF17 / BCMA (B-Cell Maturation Protein) (BCMA/2366), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details