Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Sphingosine 1-phosphate receptor 1 (s1pr1)

This Recombinant Danio rerio Sphingosine 1-phosphate receptor 1 (s1pr1) spans the amino acid sequence from region 1-362.

Product Specifications

Product Name Alternative

Sphingosine 1-phosphate receptor 1, S1P receptor 1, S1P1, Sphingosine 1-phosphate receptor Edg-1, S1P receptor Edg-1

UniProt

Q9DDK4

Expression Region

1-362

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDDLIARHYNFTGKFRKVHKDPGLKADSVVFIIVCCFIILENVLVLLTIWRTKKFHKPMY YFIGNLALSDLLAGVVYTANILLSGANTYKLTPTQWFFREGSMFVALAASVFSLLAIAIE RHLTMLKMKLHNNGKTCRVFMLISTVWFIAAILGGLPVMGWNCIDSMNNCSTVLPLYHKA YILFCTTVFSVILMAIVILYARIYALVRTRSRKLVFRKVANGRGSNKSSEKSMALLKTVI IVLSCFIACWAPLFILLLLDVACQTLTCSILYKAEWFLALAVLNSAMNPLIYTLTSNEMR RAFIKMLNCGVCVQPSGKFSRPIMGAEFSRSKSDNSSHPNKDEPEYSPRETIVSSGNITS SS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-500 1x 500 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-500 1x 500 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (CD5/54/F6), CF640R conjugate, 0.1mg/mL
BNC400746-100 1x 100 µL

CD5 (CD5/54/F6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details