Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized ABC transporter permease Mb2592 (Mb2592)

This Recombinant Uncharacterized ABC transporter permease Mb2592 (Mb2592) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease Mb2592

UniProt

P65008

Expression Region

1-349

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFAALRDVQWRKRRLVIAIVSTGLVFAMTLVLTGLVNGFRVEAERTVDSMGVDAFVVKA GAAGPFLGSTPFAQIDLPQVARAPGVLAAAPLATAPSTIRQGTSARNVTAFGAPEHGPGM PRVSDGRAPSTPDEVAVSSTLGRNLGDDLQVGARTLRIVGIVPESTALAKIPNIFLTTEG LQQLAYNGQPTISSIGIDGMPRQLPDGYQTVNRADAVSDLMRPLKVAVDAITVVAVLLWI VAALIVGSVVYLSALERLRDFAVFKAIGVPTRSILAGLALQAVVVALLAAVVGGILSLLL APLFPMTVVVPLSAFVALPAIATVIGLLASVAGLRRVVAIDPALAFGGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human B2M/beta2-MG Antibody (1A053)
MBS1579487-01 0.05 mg

Anti-Human B2M/beta2-MG Antibody (1A053)

Sign In for Pricing
View Details
Anti-Human B2M/beta2-MG Antibody (1A053)
MBS1579487-02 0.1 mg

Anti-Human B2M/beta2-MG Antibody (1A053)

Sign In for Pricing
View Details
Anti-Human B2M/beta2-MG Antibody (1A053)
MBS1579487-03 5x 0.1 mg

Anti-Human B2M/beta2-MG Antibody (1A053)

Sign In for Pricing
View Details
Lentiviral mouse Spg7 shRNA (UAS) - Lentiviral mouse Spg7 shRNA (UAS) (100)
GTR15259326 1 Vial

Lentiviral mouse Spg7 shRNA (UAS) - Lentiviral mouse Spg7 shRNA (UAS) (100)

Sign In for Pricing
View Details
CREG1 Rabbit Polyclonal Antibody
orb576655 100 µL

CREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Synaptobrevin-2
7-06824 20 µg

Recombinant Human Synaptobrevin-2

Sign In for Pricing
View Details