Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized ABC transporter permease Mb2592 (Mb2592)

This Recombinant Uncharacterized ABC transporter permease Mb2592 (Mb2592) spans the amino acid sequence from region 1-349.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease Mb2592

UniProt

P65008

Expression Region

1-349

Origin

Mycobacterium bovis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFAALRDVQWRKRRLVIAIVSTGLVFAMTLVLTGLVNGFRVEAERTVDSMGVDAFVVKA GAAGPFLGSTPFAQIDLPQVARAPGVLAAAPLATAPSTIRQGTSARNVTAFGAPEHGPGM PRVSDGRAPSTPDEVAVSSTLGRNLGDDLQVGARTLRIVGIVPESTALAKIPNIFLTTEG LQQLAYNGQPTISSIGIDGMPRQLPDGYQTVNRADAVSDLMRPLKVAVDAITVVAVLLWI VAALIVGSVVYLSALERLRDFAVFKAIGVPTRSILAGLALQAVVVALLAAVVGGILSLLL APLFPMTVVVPLSAFVALPAIATVIGLLASVAGLRRVVAIDPALAFGGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine
259548-01 25 mg

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine

Sign In for Pricing
View Details
2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine
259548-02 50 mg

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine

Sign In for Pricing
View Details
2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine
259548-03 100 mg

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine

Sign In for Pricing
View Details
2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine
259548-04 250 mg

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine

Sign In for Pricing
View Details
2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine
259548-05 500 mg

2-[2- (2-Aminophenoxy) ethoxy]-4-methyl-benzenamine

Sign In for Pricing
View Details
5' DY-480XL / 3' BBQ-650
orb1733474 20 to 29 nmol

5' DY-480XL / 3' BBQ-650

Sign In for Pricing
View Details