Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

P51357

Expression Region

1-351

Origin

Porphyra purpurea

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGQEKTRGGFDLVDDWLKRDRFVFVGWSGLLLFPCAYLAVGGWLTGTTFVTSWYTH GLASSYLEGCNFLTAAVSTPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWAFIALHGSFG LIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLMYPLGQASWFFAPSLGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVQNTLFEDGDAADTFRAFTPTQSE ETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWTSAFGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKNILLNEGIRSWMAAQDQPHENFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pttg1 (BC023324) Mouse Tagged ORF Clone
MG202008 10 µg

Pttg1 (BC023324) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LRRK2 Human Gene Knockout Kit (CRISPR)
KN216373RB 1 Kit

LRRK2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SH2D6 Human Gene Knockout Kit (CRISPR)
KN420253 1 Kit

SH2D6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), Biotin conjugate, 0.1mg/mL
BNCB2306-100 1x 100 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zfp148 Mouse Gene Knockout Kit (CRISPR)
KN519736 1 Kit

Zfp148 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DL-Dithiothreitol (DTT), 5g
PC0705-5g 5 g

DL-Dithiothreitol (DTT), 5g

Sign In for Pricing
View Details