Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cyanothece sp. Photosystem II D2 protein (psbD1)

This Recombinant Cyanothece sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

B1WQ89

Expression Region

1-351

Origin

Cyanothece sp. (strain ATCC 51142)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPERGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYLALGGWLTGTTFVTSWYTH GLASSYLEGCNFLTVAVSSPANAFGHSLLFLWGPEAQGDFTRWCQIGGLWTFTALHGAFG LIGFMLRQFEIARLVGIRPYNAIAFSAPIAVFVSVFLMYPLGQSSWFFGPSFGVAGIFRF ILFLQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLFEDGEQANTFRAFEPTQAE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKNILLNEGLRAWMAPQDQPHQNFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-100 1x 100 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-500 1x 500 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL
BNC680745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL
BNC740812-100 1x 100 µL

Tyrosinase (OCA1/812), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL
BNC942385-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2385), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF740 conjugate, 0.1mg/mL
BNC742897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details