Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q4G395

Expression Region

1-351

Origin

Emiliania huxleyi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGQKQDRGVFDLIDDWLKRDRFVFVGWSGLLLFPCAFLAVGGWLTGITFVTSWYTH GLASSFLEGCNFLTAAVSTPANSMGHSLLLLWGPEAQGDITRWFQIGGLWTFVALHGSFG VIGFCLRQFEIARLVGIRPYNAIAFSGPIAVFVTVFLVYPLGQASWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGDAANTFRAFTPTQSE ETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVAGMWTSAIGIVGLALNLRAYDFVSQ ELRAAEDPEFETFYTKNNLLNEGIRSWMAAQDQPHENFIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MADCAM1 Polyclonal Antibody, Biotin Conjugated
A64729-050 50 µL

MADCAM1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ATP2A2 Protein Vector (Mouse) (pPM-C-His)
PV157233 500 ng

ATP2A2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
LIPH Human Over-expression Lysate
orb1356024 100 µg

LIPH Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)
MBS1430140-01 0.02 mg (E-Coli)

Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)

Sign In for Pricing
View Details
Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)
MBS1430140-02 0.1 mg (E-Coli)

Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)

Sign In for Pricing
View Details
Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)
MBS1430140-03 0.02 mg (Yeast)

Recombinant Lactobacillus sakei subsp. sakei UPF0298 protein LCA_1075 (LCA_1075)

Sign In for Pricing
View Details