Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem II D2 protein (psbD)

This Recombinant Prochlorococcus marinus Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q7V6I0

Expression Region

1-351

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYTH GIASSYLEGCNFLSAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWTFVALHGSFS LIGFMLRQFEIARLVGIRPYNALAFSGPVVVFLACFLIYPLGQHSWFFAPSFGVAAIFRF ILFLQGFHNWTLNPFHMMGVAGILGGALLCGIHGATVQNTLFEDGAMSNTFKGFDPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGMWTPSVGIVGLAVNLRAYDFVSQ EVRAAEDPEFETFYTKNVLLNEGIRAWMSVADQPHENFVFPEEVMPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PADI4 Rabbit pAb, PE-Cy5 conjugated
orb2850504 100 µL

PADI4 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal ZBED2 Antibody [Janelia Fluor 549]
NBP1-77349JF549 0.1 mL

Rabbit Polyclonal ZBED2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Atad5 3'UTR GFP Stable Cell Line
TU251008 1.0 mL

Atad5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PK (Pyruvate Kinase (Liver And RBC) Chicken ELISA Kit
F9009 96 Tests

PK (Pyruvate Kinase (Liver And RBC) Chicken ELISA Kit

Sign In for Pricing
View Details
ACY1 Polyclonal Antibody
MBS2520678-01 0.02 mL

ACY1 Polyclonal Antibody

Sign In for Pricing
View Details
ACY1 Polyclonal Antibody
MBS2520678-02 0.06 mL

ACY1 Polyclonal Antibody

Sign In for Pricing
View Details