Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Photosystem II D2 protein (psbD)

This Recombinant Prochlorococcus marinus Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q7V6I0

Expression Region

1-351

Origin

Prochlorococcus marinus (strain MIT 9313)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRAPQRGWFDVLDDWLKRDRFVFVGWSGLLLFPTAYLALGGWFTGTTFVTSWYTH GIASSYLEGCNFLSAAVSTPADAMGHSLLLLWGPEAQGDFVRWCQLGGLWTFVALHGSFS LIGFMLRQFEIARLVGIRPYNALAFSGPVVVFLACFLIYPLGQHSWFFAPSFGVAAIFRF ILFLQGFHNWTLNPFHMMGVAGILGGALLCGIHGATVQNTLFEDGAMSNTFKGFDPTQEE ETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGMWTPSVGIVGLAVNLRAYDFVSQ EVRAAEDPEFETFYTKNVLLNEGIRAWMSVADQPHENFVFPEEVMPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD164 Antibody (006) [PerCP]
NBP2-90082PCP 0.1 mL

Rabbit Monoclonal CD164 Antibody (006) [PerCP]

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)
MBS7036266-01 0.02 mg

Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)
MBS7036266-02 0.1 mg

Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)
MBS7036266-03 5x 0.1 mg

Recombinant Arabidopsis thaliana Probable inactive receptor kinase At3g02880 (At3g02880)

Sign In for Pricing
View Details
Ceramide glucosyltransferase (UGCG) Rat ELISA Kit
C2980 96 Tests

Ceramide glucosyltransferase (UGCG) Rat ELISA Kit

Sign In for Pricing
View Details
Ferroportin Biosimilar (Amgen patent SLC40A1 Reference Antibody)
orb2702825-01 1 mg

Ferroportin Biosimilar (Amgen patent SLC40A1 Reference Antibody)

Sign In for Pricing
View Details