Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-351.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q9TM47

Expression Region

1-351

Origin

Cyanidium caldarium

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGREQERGWFDLLDDWLKRDRFVFIGWSGILLFPCAYLALGAWFTGTTFVSSWYTH GLASSYLEGCNFLTAAVSSPANSMGHSLLFLWGPEAQGDFTRWCQIGGLWTFTALHGSFG LIGFCLRQFEIARLVGLRPYNAIAFSGPIAVFVSVFLLYPLGQASWFFAPSFGVAAIFRF LLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLFEDGEASDTFRAFTPTQSE ETYSMVTANRFWSQIFGVAFANKRWLHFFLLFVPVTGLWVSSIGIVGLALNLRAYDFVSQ EIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENFVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2 (NM_002914) Human Over-expression Lysate
LC419017 20 µg

RFC2 (NM_002914) Human Over-expression Lysate

Sign In for Pricing
View Details
NIACR2 sgRNA CRISPR Lentivector (Human) (Target 3)
K1426704 1.0 µg DNA

NIACR2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RING Finger Protein 133 (RNF133, E3 Ubiquitin-protein Ligase RNF133) (MaxLight 405)
MBS6392677-01 0.1 mL

RING Finger Protein 133 (RNF133, E3 Ubiquitin-protein Ligase RNF133) (MaxLight 405)

Sign In for Pricing
View Details
RING Finger Protein 133 (RNF133, E3 Ubiquitin-protein Ligase RNF133) (MaxLight 405)
MBS6392677-02 5x 0.1 mL

RING Finger Protein 133 (RNF133, E3 Ubiquitin-protein Ligase RNF133) (MaxLight 405)

Sign In for Pricing
View Details
Rabbit anti-EF-1 delta Antibody, Affinity Purified
A301-683A 20 µg

Rabbit anti-EF-1 delta Antibody, Affinity Purified

Sign In for Pricing
View Details
Mycoplasma Hominis
353480 1 mg

Mycoplasma Hominis

Sign In for Pricing
View Details