Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1)

This Recombinant Synechococcus sp. Photosystem II D2 protein (psbD1) spans the amino acid sequence from region 1-352.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q2JRJ5

Expression Region

1-352

Origin

Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAVGRARQERGWFDIVDDWLKRDRFVFIGWSGLLLFPCAYLALGGWLTGTTFVTSWYT HGLASSYLEGCNFLTVAVSTPADSMGHSLLLLWGPEAQGDFTRWCQIGGLWTFVAFHGAL GLIGFMLRQFEIARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFR FLLFFQGFHNWTLNPFHMMGVAGVLGGALLCAIHGATVENTLYKDGEAASTFRAFEPTQA EETYSMVTANRYWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSIGVVGLALNLRAYDFIS QETRAAEDPEFETFYTKNILLNEGIRAWMAPQDQPHERFEFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Suv39h1 Pre-designed siRNA Set B
SI214024B 1 Each

Rat Suv39h1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Genorise® Biotinylated Ferret NGFB Polyclonal Antibody
GR214025 50 µg

Genorise® Biotinylated Ferret NGFB Polyclonal Antibody

Sign In for Pricing
View Details
Human Wilms tumor protein (WT1) ELISA Kit
KTE60017-01 48 Tests

Human Wilms tumor protein (WT1) ELISA Kit

Sign In for Pricing
View Details
Human Wilms tumor protein (WT1) ELISA Kit
KTE60017-02 96 Tests

Human Wilms tumor protein (WT1) ELISA Kit

Sign In for Pricing
View Details
Human Wilms tumor protein (WT1) ELISA Kit
KTE60017-03 5x 96 Tests

Human Wilms tumor protein (WT1) ELISA Kit

Sign In for Pricing
View Details
Human Wilms tumor protein (WT1) ELISA Kit
KTE60017-04 50x 96 Tests

Human Wilms tumor protein (WT1) ELISA Kit

Sign In for Pricing
View Details