Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dioscorea elephantipes Photosystem II D2 protein (psbD)

This Recombinant Dioscorea elephantipes Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

A6MMK2

Expression Region

1-353

Origin

Dioscorea elephantipes (Elephant's foot)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAAGRFTKEENDLFDIMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWTFVALHGA FGLIGFMLRQFELARSVQLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS711270 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
Recombinant Mouse FTMT protein (His tag)
PDEM100314-01 20 µg

Recombinant Mouse FTMT protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FTMT protein (His tag)
PDEM100314-02 100 µg

Recombinant Mouse FTMT protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FTMT protein (His tag)
PDEM100314-03 500 µg

Recombinant Mouse FTMT protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse FTMT protein (His tag)
PDEM100314-04 1 mg

Recombinant Mouse FTMT protein (His tag)

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF568 conjugate, 0.1mg/mL
BNC680487-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details