Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta obtusiflora Photosystem Q (B) protein

This Recombinant Cuscuta obtusiflora Photosystem Q (B) protein spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A8W3H2

Expression Region

1-353

Origin

Cuscuta obtusiflora (Peruvian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVVLDRRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANKGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLATFEVSATNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zaltoprofen beta-D-Glucuronide
TRC-Z146010-100MG 100 mg

Zaltoprofen beta-D-Glucuronide

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF640R conjugate, 0.1mg/mL
BNC401907-100 1x 100 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL
BNC040778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL
BNC742000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EMX2 Human Gene Knockout Kit (CRISPR)
KN422758 1 Kit

EMX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cadherin 8 (CDH8) (NM_001796) Human Over-expression Lysate
LC400680 20 µg

Cadherin 8 (CDH8) (NM_001796) Human Over-expression Lysate

Sign In for Pricing
View Details