Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta obtusiflora Photosystem Q (B) protein

This Recombinant Cuscuta obtusiflora Photosystem Q (B) protein spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein, EC= 1.10.3.9, 32 kDa thylakoid membrane protein, Photosystem II protein D1

UniProt

A8W3H2

Expression Region

1-353

Origin

Cuscuta obtusiflora (Peruvian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTVVLDRRKSENLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFLIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASIAEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAIAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTESESANKGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVIGIWFTALGISTMAFNLNGF NFNQSVVDSKGHVINTWADIINRANLGMEVMHERNAHNFPLDLATFEVSATNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8/18 (C-43 + DC10), 0.2mg/mL
BNUB0770-100 1x 100 µL

Cytokeratin 8/18 (C-43 + DC10), 0.2mg/mL

Sign In for Pricing
View Details
Benzoyl Ecgonine Ethyl Ester-d8
TRC-B208128-5MG 5 mg

Benzoyl Ecgonine Ethyl Ester-d8

Sign In for Pricing
View Details
RNASEH2B Rabbit Polyclonal Antibody
TA361601 100 µL

RNASEH2B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEK5 (MAP2K5) Human Gene Knockout Kit (CRISPR)
KN203171LP 1 Kit

MEK5 (MAP2K5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ScavengePore Benzylamine
SC11102.25G 25 g

ScavengePore Benzylamine

Sign In for Pricing
View Details
GLYR1 Polyclonal Antibody
E-AB-13272-01 20 µL

GLYR1 Polyclonal Antibody

Sign In for Pricing
View Details