Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Photosystem II D2 protein (psbD)

This Recombinant Photosystem II D2 protein (psbD) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

Photosystem II D2 protein, PSII D2 protein, EC= 1.10.3.9, Photosystem Q (A) protein

UniProt

Q1KVW6

Expression Region

1-353

Origin

Scenedesmus obliquus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIAIGSTYQEKRTWFDDADDWLRQDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWY THGLATSYLEGCNFLTAAVSTPANSMAHSLLFLWGPEAQGDFTRWCQLGGLWTFVALHGS FGLIGFMLRQFEIARSVNLRPYNAIAFSAPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIF RFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQ AEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLLVPVTGLWMSAIGVVGLALNLRAYDFV SQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHERLVFPEEVLPRGNAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD34 Antibody (rHPCA1/8573) [DyLight 488]
NBP3-20987G 0.1 mL

Mouse Monoclonal CD34 Antibody (rHPCA1/8573) [DyLight 488]

Sign In for Pricing
View Details
KCNT2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1125706 1.0 µg DNA

KCNT2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Active Parathyroid Hormone Related Protein (PTHrP)
SBPA187Mu01-01 10 µg

Active Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details
Active Parathyroid Hormone Related Protein (PTHrP)
SBPA187Mu01-02 50 µg

Active Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details
Active Parathyroid Hormone Related Protein (PTHrP)
SBPA187Mu01-03 200 µg

Active Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details
Active Parathyroid Hormone Related Protein (PTHrP)
SBPA187Mu01-04 1 mg

Active Parathyroid Hormone Related Protein (PTHrP)

Sign In for Pricing
View Details