Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0421 protein ygaE (ygaE)

This Recombinant Bacillus subtilis UPF0421 protein ygaE (ygaE) spans the amino acid sequence from region 1-353.

Product Specifications

Product Name Alternative

UPF0421 protein ygaE

UniProt

P71083

Expression Region

1-353

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLGARIFKTGIAITLALYLASWIGLPAPIFAGIAAIFAIQPSIYRSFLIIIDQVQANII GAVIATVFGLIFGPSPIMIGLTAVIVITIMLKLKIEHTISIALVTVIAILESAGDDFLMF ALIRTSTVILGVLSSFIVNLVFLPPKYETKLIHNTVENTEEIMKWIRLSMRQSTEHSILK EDIEKLKEKMIKLDQTYLLYKEERSYFKKTTYVKSRKLVLFRQAIITANRALDTLKKLHR LENEIYHMPEEFQETLTEELDYLLYWHERILMRFVGKIKPHDDAVEEGIRYKQLLTKSFL KNQQNTDEELIDYNMLNIMASAVEYREQLEHLETLITSFQTYHPKDCEIETEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERGIC1 (NM_001031711) Human Tagged ORF Clone Lentiviral Particle
RC203612L3V 200 µL

ERGIC1 (NM_001031711) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mapk14 (NM_001168513) Mouse Tagged ORF Clone Lentiviral Particle
MR227429L4V 200 µL

Mapk14 (NM_001168513) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse CD28 Polyclonal Antibody
E55A03897 100 µg

Mouse CD28 Polyclonal Antibody

Sign In for Pricing
View Details
Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%
241249-01 1 g

Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%

Sign In for Pricing
View Details
Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%
241249-02 5 g

Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%

Sign In for Pricing
View Details
Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%
241249-03 25 g

Phosphoenolpyruvic acid trisodium salt heptahydrate 99+%

Sign In for Pricing
View Details