Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein U (yscU)

This Recombinant Yop proteins translocation protein U (yscU) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Yop proteins translocation protein U

UniProt

P69986

Expression Region

1-354

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACADM Human Gene Knockout Kit (CRISPR)
KN402798 1 Kit

ACADM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPART (NM_001142296) Human Recombinant Protein
TP327169M 100 µg

SPART (NM_001142296) Human Recombinant Protein

Sign In for Pricing
View Details
p-Nitrophenyl Beta-D-Xylopyranoside
TRC-N509050-500MG 500 mg

p-Nitrophenyl Beta-D-Xylopyranoside

Sign In for Pricing
View Details
Tissue Total RNA, Small intestine
CR562002 5 µg

Tissue Total RNA, Small intestine

Sign In for Pricing
View Details
ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H1]
CF806898 100 µg

ABAT Mouse Monoclonal Antibody [Clone ID: OTI6H1]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS626583 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details