Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein U (yscU)

This Recombinant Yop proteins translocation protein U (yscU) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Yop proteins translocation protein U

UniProt

P69986

Expression Region

1-354

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Cecum
CS808557 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF740 conjugate, 0.1mg/mL
BNC742130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRISP2 (NM_003296) Human Over-expression Lysate
LY418782 100 µg

CRISP2 (NM_003296) Human Over-expression Lysate

Sign In for Pricing
View Details
HSP90AB1 (NM_007355) Human Over-expression Lysate
LC402141 20 µg

HSP90AB1 (NM_007355) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS712132 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
ID2 Polyclonal Antibody
E-AB-15069-01 20 µL

ID2 Polyclonal Antibody

Sign In for Pricing
View Details