Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yop proteins translocation protein U (yscU)

This Recombinant Yop proteins translocation protein U (yscU) spans the amino acid sequence from region 1-354.

Product Specifications

Product Name Alternative

Yop proteins translocation protein U

UniProt

P69986

Expression Region

1-354

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGLSDYYFEHFSKLMLIP AEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVVQYGFLISGEAIKPDIK KINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLVTLLQLPTCGIECITPLL GQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIKREYKEMEGSPEIKSKRRQ FHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLPLVTFKYTDAQVQTVRKIAE EEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRWLERQNIEKQHSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC3R Rabbit Polyclonal Antibody
TA361222 100 µL

MC3R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BAG5 Mouse Monoclonal Antibody [Clone ID: OTI2H6]
CF810640 100 µg

BAG5 Mouse Monoclonal Antibody [Clone ID: OTI2H6]

Sign In for Pricing
View Details
Tau (Ab-519/202) Antibody
8B8067-AAT 50 µg

Tau (Ab-519/202) Antibody

Sign In for Pricing
View Details
IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), 0.2mg/mL
BNUB2001-500 1x 500 µL

IL-10R1, Mouse (Interleukin-10 Receptor 1) (CD210) (1B1.3a), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP507998 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
OR7C1 Human qPCR Primer Pair (NM_198944)
HP219452 200 Reactions

OR7C1 Human qPCR Primer Pair (NM_198944)

Sign In for Pricing
View Details