Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anabaena variabilis Photosystem Q (B) protein 6 (psbA5)

This Recombinant Anabaena variabilis Photosystem Q (B) protein 6 (psbA5) spans the amino acid sequence from region 1-356.

Product Specifications

Product Name Alternative

Photosystem Q (B) protein 6, EC= 1.10.3.9, 32 kDa thylakoid membrane protein 6, Photosystem II protein D1 6

UniProt

Q3M5L6

Expression Region

1-356

Origin

Anabaena variabilis (strain ATCC 29413 / PCC 7937)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTIVQRQKEFNFFDLWDSFCAWITSTENRIYIGWFGVLSIPTLLAATTCFVLAFIAAPS VDMDGIREPIMGSLMDGNNLITAAVVPTSAAIGLHFYPIWEAASMDEWLYNGGPYQLIVL HFLIGIWCLLGRFWELSYRLGMRPWIAVAYSAPVIAATSVLLVYPIGQGSFSDGLPLGIA GTFHFMLAFQGDHNILMHPFHMLGVAGVFGGALLSSLHGSLVASTLIRNTDENESINGGY KLGQQQVTYKYLAGHNSFLGRLLIPTFASRNHRAFHFLLAALPTIGIWFAAMGVCSMAFN LNGLNFNHSILDSRGNVIRSDADILNRANIGLSVMHAPNVHNFPLVLSSGQPIPVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 550)
247605-ML550 100 µL

IL6 (Interleukin 6 (Interferon, beta 2), BSF2, HGF, HSF, IFNB2, IL-6) (MaxLight 550)

Sign In for Pricing
View Details
FAM118B Protein Vector (Mouse) (pPB-C-His)
PV177166 500 ng

FAM118B Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Gelsolin (GSN) (NM_001127662) Human Untagged Clone
SC323184 10 µg

Gelsolin (GSN) (NM_001127662) Human Untagged Clone

Sign In for Pricing
View Details
3-Fluorobenzoic Acid
TRC-F588381-1G 1 g

3-Fluorobenzoic Acid

Sign In for Pricing
View Details
GSTA1 Rabbit Polyclonal Antibody (AP)
orb925712 100 µL

GSTA1 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Alpha-Spinsterhood acetate
orb3054274-01 25 mg

Alpha-Spinsterhood acetate

Sign In for Pricing
View Details