Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Palmitoyltransferase ZDHHC2 (Zdhhc2)

This Recombinant Mouse Palmitoyltransferase ZDHHC2 (Zdhhc2) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Palmitoyltransferase ZDHHC2, EC= 2.3.1.-, Zinc finger DHHC domain-containing protein 2, DHHC-2

UniProt

P59267

Expression Region

1-366

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSGSGGVRRRCRRVLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTRT MSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYSLL YCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSKNKS TLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFPTCLVNQD PEQPSTPAGLNSTVKNPENHQFPAKPLRESQSHLLKDSQTWTESSANPGKGKAGMSNPAL TMENET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL
BNC880096-500 1x 500 µL

Histone H1 (AE-4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF405S conjugate, 0.1mg/mL
BNC040175-500 1x 500 µL

CD46 (122.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details