Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 16

This Recombinant Zea mays CASP-like protein 16 spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

CASP-like protein 16, Vegetative cell wall protein gp1

UniProt

B6UBY6

Expression Region

1-369

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTPRTPAPERSPPPVPTPPPPLEDEPPPYLADGSPREEASFSSDGREGAPPKNPQLSP THHAAPRLVPPPSSPARQDGQEQEGSANKAAAATAEPAREPLRQMATGLARPLSSQTSPA TTNSPTPSASPTPSSPAPVANNSKRSGQSTPKRAETKLPLSSPAVAVHFDPVEEAVTSPL RLGKARLDQQQQQQHAAGAAESGASVVPGVAAAVAAVAERRELLLALRLATAVLSLAAFS VIASARTSGWAGDYYARHLQYRYAVAVNVIVFAYSVAQSLGKIRHLVSPRFTFRTMSSYY CSLFLDQVLAYLLMSASSAAASRNDLWVSRFGTDAFVRKITGALWLSFVAFLVLALNAVI SXANLFSMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase (ALPI) (NM_001631) Human Recombinant Protein
TP324178L 1 mg

Alkaline Phosphatase (ALPI) (NM_001631) Human Recombinant Protein

Sign In for Pricing
View Details
FOXD4L2 (NM_001099279) Human Over-expression Lysate
LY420418 100 µg

FOXD4L2 (NM_001099279) Human Over-expression Lysate

Sign In for Pricing
View Details
RAN (N-term) Rabbit Polyclonal Antibody
AP17702PU-N 400 µL

RAN (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CLPTM1 (NM_001294) Human Over-expression Lysate
LY400516 100 µg

CLPTM1 (NM_001294) Human Over-expression Lysate

Sign In for Pricing
View Details
TOC Analyzer BANA-601
BANA-601 1 Unit

TOC Analyzer BANA-601

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS643881 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details