Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 16

This Recombinant Zea mays CASP-like protein 16 spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

CASP-like protein 16, Vegetative cell wall protein gp1

UniProt

B6UBY6

Expression Region

1-369

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTPRTPAPERSPPPVPTPPPPLEDEPPPYLADGSPREEASFSSDGREGAPPKNPQLSP THHAAPRLVPPPSSPARQDGQEQEGSANKAAAATAEPAREPLRQMATGLARPLSSQTSPA TTNSPTPSASPTPSSPAPVANNSKRSGQSTPKRAETKLPLSSPAVAVHFDPVEEAVTSPL RLGKARLDQQQQQQHAAGAAESGASVVPGVAAAVAAVAERRELLLALRLATAVLSLAAFS VIASARTSGWAGDYYARHLQYRYAVAVNVIVFAYSVAQSLGKIRHLVSPRFTFRTMSSYY CSLFLDQVLAYLLMSASSAAASRNDLWVSRFGTDAFVRKITGALWLSFVAFLVLALNAVI SXANLFSMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Myometrium
CS501179 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF740 conjugate, 0.1mg/mL
BNC743128-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (CYCS/3128R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832D-01 20 Tests

PE Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PE Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832D-02 100 Tests

PE Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PE Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832D-03 2x 100 Tests

PE Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL
BNUB1553-500 1x 500 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), 0.2mg/mL

Sign In for Pricing
View Details