Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Zea mays CASP-like protein 16

This Recombinant Zea mays CASP-like protein 16 spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

CASP-like protein 16, Vegetative cell wall protein gp1

UniProt

B6UBY6

Expression Region

1-369

Origin

Zea mays (Maize)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTPRTPAPERSPPPVPTPPPPLEDEPPPYLADGSPREEASFSSDGREGAPPKNPQLSP THHAAPRLVPPPSSPARQDGQEQEGSANKAAAATAEPAREPLRQMATGLARPLSSQTSPA TTNSPTPSASPTPSSPAPVANNSKRSGQSTPKRAETKLPLSSPAVAVHFDPVEEAVTSPL RLGKARLDQQQQQQHAAGAAESGASVVPGVAAAVAAVAERRELLLALRLATAVLSLAAFS VIASARTSGWAGDYYARHLQYRYAVAVNVIVFAYSVAQSLGKIRHLVSPRFTFRTMSSYY CSLFLDQVLAYLLMSASSAAASRNDLWVSRFGTDAFVRKITGALWLSFVAFLVLALNAVI SXANLFSMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

cis-5-Dodecenoyl Carnitine Inner Salt
TRC-D535820-2.5MG 2.5 mg

cis-5-Dodecenoyl Carnitine Inner Salt

Sign In for Pricing
View Details
Integrin alpha-6 Antibody
KC-7681-01 50 μL

Integrin alpha-6 Antibody

Sign In for Pricing
View Details
Integrin alpha-6 Antibody
KC-7681-02 100 µL

Integrin alpha-6 Antibody

Sign In for Pricing
View Details
Integrin alpha-6 Antibody
KC-7681-03 1 mL

Integrin alpha-6 Antibody

Sign In for Pricing
View Details
IGF1 (E peptide) Rabbit Polyclonal Antibody
HA500107 100 µL

IGF1 (E peptide) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Nucleoporin p62 Antibody
RC-16325-01 50 μL

Recombinant Nucleoporin p62 Antibody

Sign In for Pricing
View Details