Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Sensor histidine kinase yvfT (yvfT)

This Recombinant Bacillus subtilis Sensor histidine kinase yvfT (yvfT) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Sensor histidine kinase yvfT, EC= 2.7.13.3

UniProt

Q795K2

Expression Region

1-371

Origin

Bacillus subtilis (strain 168)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKAISIFPKEFGFFPYIFLVYTIMPFLSLLKESGVKQGIGYGMLLLFVAAYRQLFCSVG KASFTYWLIVQMAVILMYSVFYNITYIYLGFFPANFVGYYKEKTNFNRAFCALIFILLFP CLYQFIANSVSLRELFSVLPFLVIMLISPFGIRSMFRRIELEAKLAQANEQIKELSKREE RVRIARDLHDTLGHTLSLLTLKSQLIQRLAASDPERTKLEAKEMETSSRSALKQVRELVS DMRTVTITEELVNIQHILRAGNITFQYEGADDFSVISPVTQNIISMCMREAVTNIIKHSK ATHCAITISQFADKMRIVIRDDGKGAPKEKMFGNGLWGMEERLMLIEGGLTVSDHNGTVV ALTIPLIKKAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Rabbit Polyclonal Antibody
TA375754 100 µL

EGFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL
BNC470918-500 1x 500 µL

CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPART (NM_001142294) Human Over-expression Lysate
LY428017 100 µg

SPART (NM_001142294) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS510601 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A,  10nm
GAP-01-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Protein A, 10nm

Sign In for Pricing
View Details
SKP2 (p45) Rabbit Polyclonal Antibody
AP06317PU-N 100 µg

SKP2 (p45) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details