Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative phosphatidate phosphatase (wun)

This Recombinant Drosophila melanogaster Putative phosphatidate phosphatase (wun) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Putative phosphatidate phosphatase, EC= 3.1.3.4, Germ cell guidance factor, Phosphatidic acid phosphatase type 2, Protein wunen

UniProt

Q9V576

Expression Region

1-379

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL QEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFC DDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNY ELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAIN AGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLFQKPNTKPYLA RTVQDMNASPAQAITITTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT7A Human Gene Knockout Kit (CRISPR)
KN402417 1 Kit

WNT7A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P53 (BP53-12 + DO-7), CF405S conjugate, 0.1mg/mL
BNC040723-500 1x 500 µL

P53 (BP53-12 + DO-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Myometrium
CR559120 5 µg

Tissue Total RNA, Myometrium

Sign In for Pricing
View Details
SCD1 (SCD) (C-term) Goat Polyclonal Antibody
AP22447PU-N 100 µg

SCD1 (SCD) (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Diethyl a-Acetylglutarate
TRC-D443510-25G 25 g

Diethyl a-Acetylglutarate

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS700819 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details