Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative phosphatidate phosphatase (wun)

This Recombinant Drosophila melanogaster Putative phosphatidate phosphatase (wun) spans the amino acid sequence from region 1-379.

Product Specifications

Product Name Alternative

Putative phosphatidate phosphatase, EC= 3.1.3.4, Germ cell guidance factor, Phosphatidic acid phosphatase type 2, Protein wunen

UniProt

Q9V576

Expression Region

1-379

Origin

Drosophila melanogaster (Fruit fly)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAVKIIMSTETSASETTPLRRSENETPDHKELAQSNSNSRQTTVNSNNNNYSNSVQVRL QEQDRDSDSEQQQHTATITMDTNKRILCRVGLDVLILLCAGFPILLFFLLGEPYKRGFFC DDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNY ELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAIN AGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARMTWRGSKLLRH LLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVANYVSDLFQKPNTKPYLA RTVQDMNASPAQAITITTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GALM Polyclonal Antibody
E-AB-90817-01 60 µL

GALM Polyclonal Antibody

Sign In for Pricing
View Details
GALM Polyclonal Antibody
E-AB-90817-02 120 µL

GALM Polyclonal Antibody

Sign In for Pricing
View Details
GALM Polyclonal Antibody
E-AB-90817-03 200 µL

GALM Polyclonal Antibody

Sign In for Pricing
View Details
7-Ethyl-10-(4-amino-1-piperidino)carbonyloxycamptothecin Dihydrochloride
TRC-E899155-5MG 5 mg

7-Ethyl-10-(4-amino-1-piperidino)carbonyloxycamptothecin Dihydrochloride

Sign In for Pricing
View Details
Themis Mouse Gene Knockout Kit (CRISPR)
KN517525 1 Kit

Themis Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF568 conjugate, 0.1mg/mL
BNC682674-500 1x 500 µL

CD117 / c-Kit (Marker for Gastrointestinal Stromal Tumors) (KIT/2674), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details