Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-1 protein (Gja1)

This Recombinant Rat Gap junction alpha-1 protein (Gja1) spans the amino acid sequence from region 2-382.

Product Specifications

Product Name Alternative

Gap junction alpha-1 protein, Connexin-43, Cx43, Gap junction 43 kDa heart protein

UniProt

P08050

Expression Region

2-382

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM 1 (HAVCR1) (NM_001099414) Human Recombinant Protein
TP317289 20 µg

TIM 1 (HAVCR1) (NM_001099414) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS646839 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tenm4 Mouse Gene Knockout Kit (CRISPR)
KN517409 1 Kit

Tenm4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Osteopontin (OPN) ELISA Kit
RD-OPN-Mu-01 96 Tests

Mouse Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
Mouse Osteopontin (OPN) ELISA Kit
RD-OPN-Mu-02 48 Tests

Mouse Osteopontin (OPN) ELISA Kit

Sign In for Pricing
View Details
PACS1 Human Gene Knockout Kit (CRISPR)
KN204036RB 1 Kit

PACS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details