Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction alpha-1 protein (Gja1)

This Recombinant Rat Gap junction alpha-1 protein (Gja1) spans the amino acid sequence from region 2-382.

Product Specifications

Product Name Alternative

Gap junction alpha-1 protein, Connexin-43, Cx43, Gap junction 43 kDa heart protein

UniProt

P08050

Expression Region

2-382

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSALGKLLDKVQAYSTAGGKVWLSVLFIFRILLLGTAVESAWGDEQSAFRCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSVPTLLYLAHVFYVMRKEEKLNKKEEELKVAQTDGV NVEMHLKQIEIKKFKYGIEEHGKVKMRGGLLRTYIISILFKSVFEVAFLLIQWYIYGFSL SAVYTCKRDPCPHQVDCFLSRPTEKTIFIIFMLVVSLVSLALNIIELFYVFFKGVKDRVK GRSDPYHATTGPLSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNY NKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQ RPSSRASSRASSRPRPDDLEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Polyclonal Antibody
E-AB-V1132-01 20 µL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Polyclonal Antibody
E-AB-V1132-02 100 µL

Anti-Ebola virus EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Polyclonal Antibody

Sign In for Pricing
View Details
CENPH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E8]
TA503869BM 100 µL

CENPH Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2E8]

Sign In for Pricing
View Details
APOBEC4 (NM_203454) Human Recombinant Protein
TP760700 50 µg

APOBEC4 (NM_203454) Human Recombinant Protein

Sign In for Pricing
View Details
APOB48R (APOBR) Mouse Monoclonal Antibody [Clone ID: OTI2E6]
CF807047 100 µg

APOB48R (APOBR) Mouse Monoclonal Antibody [Clone ID: OTI2E6]

Sign In for Pricing
View Details
Recombinant EWSR1 Antibody
RC-4882-01 50 μL

Recombinant EWSR1 Antibody

Sign In for Pricing
View Details