Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein flhB (flhB)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Flagellar biosynthetic protein flhB (flhB) spans the amino acid sequence from region 1-382.

Product Specifications

Product Name Alternative

Flagellar biosynthetic protein flhB

UniProt

Q89AN6

Expression Region

1-382

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNHDESEEKTESPTSYRLKISKETGHNRYYRELYSLLILTITLINFWYNQRLILTLLKRI FYLSFTFNNSIFQNDLFLDHNFLMIFQDNLISLLGIIFFPMLIFMFPAMILCCSNFNFKF IKFDINKLNPILGFKNVFSIKSIVDLFKTVLKIVFVSIVVYLFISKYFLKVCFSSNFTFD YILNYSVRTIFLCFLTILIFFIPIIIIDLFWEKYNFYRSLRMTRKEVSDELKNMEGNPRI KSRIRQIMFSISNRRMLSNVSKSDVIVVNPMHYAIAIKYNETNMYAPKILAKGIDELAIK IKKIGNNHSIPTLVSHSLAHVLYYRTEVGEYIPSVLYEAVAEVLAWVWKIRHWKIKGGVF PRTPEKFFIPSELYEKRIKKRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF647 conjugate, 0.1mg/mL
BNC470342-100 1x 100 µL

CD43 (84-3C1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF405S conjugate, 0.1mg/mL
BNC040245-100 1x 100 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL
BNC801797-100 1x 100 µL

Histone H1 (Nuclear Marker) (r1415-1), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF488A conjugate, 0.1mg/mL
BNC881125-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF647 conjugate, 0.1mg/mL
BNC471587-100 1x 100 µL

CD62L (L-Selectin) (LAM1-116), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details