Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ceramide synthase 6 (Cers6)

This Recombinant Mouse Ceramide synthase 6 (Cers6) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Ceramide synthase 6, CerS6, LAG1 longevity assurance homolog 6

UniProt

Q8C172

Expression Region

1-384

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFIA KPCAIALNIQANGPQTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR RNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPLTADLHY YYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLVLCLHDS ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS WWVFNLLLLLLQGLNCFWSYLIVKIACKTVSKGKVSKDDRSDIESSSDDEDSEPPGKKPH SSTTTNGTSGTNGYLLTGPCSVDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Candida auris Beta-1,3 Glucan Antibody
abx422598-01 100 µg

Candida auris Beta-1,3 Glucan Antibody

Sign In for Pricing
View Details
Candida auris Beta-1,3 Glucan Antibody
abx422598-02 1 mg

Candida auris Beta-1,3 Glucan Antibody

Sign In for Pricing
View Details
ID4 Rabbit Polyclonal Antibody (HRP)
orb2129660 100 µL

ID4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (MaxLight 550)
MBS6367126-01 0.1 mL

ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (MaxLight 550)

Sign In for Pricing
View Details
ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (MaxLight 550)
MBS6367126-02 5x 0.1 mL

ZNF580, ID (ZNF580, Zinc finger protein 580, LDL-induced EC protein) (MaxLight 550)

Sign In for Pricing
View Details
PTGES2 (Prostaglandin E Synthase 2, Microsomal Prostaglandin E Synthase 2, mPGES-2, C9orf15, PGES2, FLJ14038, MGC11289) (MaxLight 750) discontinued
132028-ML750 100 µL

PTGES2 (Prostaglandin E Synthase 2, Microsomal Prostaglandin E Synthase 2, mPGES-2, C9orf15, PGES2, FLJ14038, MGC11289) (MaxLight 750) discontinued

Sign In for Pricing
View Details