Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ceramide synthase 6 (Cers6)

This Recombinant Mouse Ceramide synthase 6 (Cers6) spans the amino acid sequence from region 1-384.

Product Specifications

Product Name Alternative

Ceramide synthase 6, CerS6, LAG1 longevity assurance homolog 6

UniProt

Q8C172

Expression Region

1-384

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGILAWFWNERFWLPHNVTWADLKNTEEATFPQAEDLYLAFPLAFCIFMVRLIFERFIA KPCAIALNIQANGPQTAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQR RNQEKPSTLTRFCESMWRFSFYLYVFSYGVRFLKQTPWLWNTRHCWYNYPYQPLTADLHY YYILELSFYWSLMVSQFTDIKRKDFGIMFLHHLATIFLITFSYVNNMARVGTLVLCLHDS ADALLEAAKMANYAKFQKMCDLLFVMFAVVFITTRLGIFPLWVLNTTLFESWEIVGPYPS WWVFNLLLLLLQGLNCFWSYLIVKIACKTVSKGKVSKDDRSDIESSSDDEDSEPPGKKPH SSTTTNGTSGTNGYLLTGPCSVDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Mouse CD117/c-Kit Antibody[2B8]
E-AB-F1092C-01 50 Tests

FITC Anti-Mouse CD117/c-Kit Antibody[2B8]

Sign In for Pricing
View Details
FITC Anti-Mouse CD117/c-Kit Antibody[2B8]
E-AB-F1092C-02 100 Tests

FITC Anti-Mouse CD117/c-Kit Antibody[2B8]

Sign In for Pricing
View Details
FITC Anti-Mouse CD117/c-Kit Antibody[2B8]
E-AB-F1092C-03 2x 100 Tests

FITC Anti-Mouse CD117/c-Kit Antibody[2B8]

Sign In for Pricing
View Details
Block, 12 x 15ml centrifuge tubes
BSW15 1 Each

Block, 12 x 15ml centrifuge tubes

Sign In for Pricing
View Details
RAB39A Polyclonal Antibody
E-AB-90380-01 60 µL

RAB39A Polyclonal Antibody

Sign In for Pricing
View Details
RAB39A Polyclonal Antibody
E-AB-90380-02 120 µL

RAB39A Polyclonal Antibody

Sign In for Pricing
View Details