Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q998M2

Expression Region

2-389

Origin

Hepatitis B virus genotype D subtype ayw (isolate Australia/AustKW/1991) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQ DPRVRGLYLPAGGSSSGTVNPVPTTASPTLSTSSRIGDPALNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYNTLSPFLPLLPIFFYLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IGHG1 Protein
MBS8249215-01 0.01 mg

Recombinant Mouse IGHG1 Protein

Sign In for Pricing
View Details
Recombinant Mouse IGHG1 Protein
MBS8249215-02 0.05 mg

Recombinant Mouse IGHG1 Protein

Sign In for Pricing
View Details
Recombinant Mouse IGHG1 Protein
MBS8249215-03 0.5 mg

Recombinant Mouse IGHG1 Protein

Sign In for Pricing
View Details
Recombinant Mouse IGHG1 Protein
MBS8249215-04 5x 0.5 mg

Recombinant Mouse IGHG1 Protein

Sign In for Pricing
View Details
Porcine 5-Nucleotidase ELISA Kit
MBS738335-01 48 Well

Porcine 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details
Porcine 5-Nucleotidase ELISA Kit
MBS738335-02 96 Well

Porcine 5-Nucleotidase ELISA Kit

Sign In for Pricing
View Details