Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q998M2

Expression Region

2-389

Origin

Hepatitis B virus genotype D subtype ayw (isolate Australia/AustKW/1991) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPLSPPLRTTHPQAMQWNSTTFHQTLQ DPRVRGLYLPAGGSSSGTVNPVPTTASPTLSTSSRIGDPALNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLSFLGGTTVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYNTLSPFLPLLPIFFYLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (APC)
135268-APC 100 µL

VPREB3 (Pre-B Lymphocyte Protein 3, Protein VPreB3, N27C7-2, UNQ355/PRO619, 8HS20) (APC)

Sign In for Pricing
View Details
PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 4)
489630 100 µL

PSMD4 (26S Proteasome Non-ATPase Regulatory Subunit 4, Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 4)

Sign In for Pricing
View Details
ST5 Antibody, HRP conjugated
A35725-50UL 50 μL

ST5 Antibody, HRP conjugated

Sign In for Pricing
View Details
HABP4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15402R-BF594 100 µL

HABP4 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Bovine Embryo Trachea Cells
AFG-ELL-3826 > 1x 10^6 Cells / Vial

Bovine Embryo Trachea Cells

Sign In for Pricing
View Details
Rabbit Polyclonal DOCK10 Antibody [FITC]
NB100-60669F 0.1 mL

Rabbit Polyclonal DOCK10 Antibody [FITC]

Sign In for Pricing
View Details