Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl2769/cg3067 (Cgl2769, cg3067)

This Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl2769/cg3067 (Cgl2769, cg3067) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Uncharacterized protein Cgl2769/cg3067

UniProt

Q99340

Expression Region

1-389

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amodiaquine Dihydrochloride Dihydrate
TRC-A634190-5G 5 g

Amodiaquine Dihydrochloride Dihydrate

Sign In for Pricing
View Details
RAF1 pThr269 Rabbit Polyclonal Antibody
AP12797PU-N 400 µL

RAF1 pThr269 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF423 Human Gene Knockout Kit (CRISPR)
KN418703 1 Kit

ZNF423 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1151-01 50 μL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1151-02 100 µL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1151-03 1 mL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details