Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl2769/cg3067 (Cgl2769, cg3067)

This Recombinant Corynebacterium glutamicum Uncharacterized protein Cgl2769/cg3067 (Cgl2769, cg3067) spans the amino acid sequence from region 1-389.

Product Specifications

Product Name Alternative

Uncharacterized protein Cgl2769/cg3067

UniProt

Q99340

Expression Region

1-389

Origin

Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKLGTVARLSELDKSLRNRLLRVRSRLLFIVHSAIGAGVAYWIAVEVIKHGQPFFAP MSAVIILGLSGGDRIKRATELTLGCALGVGLGDLLIMQIGTGYWQIFVVVGLALLVASFV SPAPLVSNQMAIGGILIATMFPPGDGGSIDRMIDAFIGGGVGILVIALLPSSPLDAGRHQ VANVLGIAASVLEDVAASLKAKDAAKLNNALEALRRSQASVNKLETAASSGKEATTVSPF LWGDRARVRSLYRILAPVDNVIRNARVLARRAVVLTEDNDTVSDEQIHVIEEIADIALRL SDLYEHHKEISEALEIPELVNRLRQLGSEVGEDIAEDRVLSAQVILAQSRSIIVDLLQIC GMSRESAVAVLVPTSESPAYPPELWDDED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF20 shRNA Plasmid (m)
sc-153035-SH 20 µg

RNF20 shRNA Plasmid (m)

Sign In for Pricing
View Details
Mouse Monoclonal DPP8 Antibody (OTI1D2) [Alexa Fluor 594]
NBP2-71972AF594 0.1 mL

Mouse Monoclonal DPP8 Antibody (OTI1D2) [Alexa Fluor 594]

Sign In for Pricing
View Details
Biotin anti-mouse CD4
GT00117 500 µg

Biotin anti-mouse CD4

Sign In for Pricing
View Details
PDSS2 shRNA Plasmid (m)
sc-76101-SH 20 µg

PDSS2 shRNA Plasmid (m)

Sign In for Pricing
View Details
EMSA Probe ARE (10μM)
GS013A 30 μL

EMSA Probe ARE (10μM)

Sign In for Pricing
View Details
Rabbit Polyclonal SIN3A Antibody
NB100-2252 0.1 mL

Rabbit Polyclonal SIN3A Antibody

Sign In for Pricing
View Details