Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ceramide glucosyltransferase (Ugcg)

This Recombinant Mouse Ceramide glucosyltransferase (Ugcg) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Ceramide glucosyltransferase, EC= 2.4.1.80, GLCT-1, Glucosylceramide synthase, GCS, UDP-glucose ceramide glucosyltransferase, UDP-glucose:N-acylsphingosine D-glucosyltransferas

UniProt

O88693

Expression Region

1-394

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVG INPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGF AATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA KAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT IYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 650)
MBS6225153-01 0.1 mL

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 650)

Sign In for Pricing
View Details
TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 650)
MBS6225153-02 5x 0.1 mL

TOE1 (Target of EGR1 Protein 1, FLJ13949) (MaxLight 650)

Sign In for Pricing
View Details
VSIG4, CT (VSIG4, CRIg, Z39IG, V-set and immunoglobulin domain-containing protein 4, Protein Z39Ig) (PE) discontinued
043784-PE 200 µL

VSIG4, CT (VSIG4, CRIg, Z39IG, V-set and immunoglobulin domain-containing protein 4, Protein Z39Ig) (PE) discontinued

Sign In for Pricing
View Details
Mitofusin-2 (D2D10) Rabbit Monoclonal Antibody (BSA and Azide Free)
CST 92271SF 100 µg

Mitofusin-2 (D2D10) Rabbit Monoclonal Antibody (BSA and Azide Free)

Sign In for Pricing
View Details
Dinoprost (Prostaglandin F2??) 5mg
A16333-5 5 mg

Dinoprost (Prostaglandin F2??) 5mg

Sign In for Pricing
View Details
Phpt1 (NM_029293) Mouse Tagged ORF Clone Lentiviral Particle
MR200633L3V 200 µL

Phpt1 (NM_029293) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details