Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ad Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ad Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P03140

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ad (isolate Japan/S-179/1988) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMENTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class II I-Ek Mouse Monoclonal Antibody [Clone ID: 14-4-4S]
CL074R 50 µg

MHC Class II I-Ek Mouse Monoclonal Antibody [Clone ID: 14-4-4S]

Sign In for Pricing
View Details
Mouse Arhgap8 activation kit by CRISPRa
GA209416 1 Kit

Mouse Arhgap8 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IL-23 (Interleukin 23) ELISA Kit
E-EL-M0731-01 24 Tests

Mouse IL-23 (Interleukin 23) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-23 (Interleukin 23) ELISA Kit
E-EL-M0731-02 48 Tests

Mouse IL-23 (Interleukin 23) ELISA Kit

Sign In for Pricing
View Details
Mouse IL-23 (Interleukin 23) ELISA Kit
E-EL-M0731-03 96 Tests

Mouse IL-23 (Interleukin 23) ELISA Kit

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (57), 1mg/mL
BNUM0139-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (57), 1mg/mL

Sign In for Pricing
View Details