Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype F1 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype F1 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q99HS3

Expression Region

2-400

Origin

Hepatitis B virus genotype F1 (isolate Argentina/sa11/2000) (HBV-F)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTTRRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNKNKDNWPMANKVGVG GYGPGFTPPHGGLLGWSPQAQGVLTTLPADPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRALYFPAGGSSSETQNPAPTIASLTSSIFLKTGGPATNMDNITSG LLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPGQNSQSPTSNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDYQGMLPVCPPLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF594 conjugate, 0.1mg/mL
BNC940698-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF647 conjugate, 0.1mg/mL
BNC470507-500 1x 500 µL

Human IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker) (IG507R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF640R conjugate, 0.1mg/mL
BNC400414-100 1x 100 µL

Chromogranin A (CGA/414), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF405S conjugate, 0.1mg/mL
BNC041930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL
BNC041711-500 1x 500 µL

Desmin (Muscle Cell Marker) (DES/1711), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details