Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant TM2 domain-containing protein ZK858.5 (ZK858.5)

This Recombinant TM2 domain-containing protein ZK858.5 (ZK858.5) spans the amino acid sequence from region 1-409.

Product Specifications

Product Name Alternative

TM2 domain-containing protein ZK858.5

UniProt

Q94421

Expression Region

1-409

Origin

Caenorhabditis elegans

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNEETEVKPWIVRIILIVGGLFGAHRLYLKQVPEAFVFFSTLGVLLIGWLYDSFMFKYE VNEYNQLINQSENNKEKEKWKNGKMQASQSKFVDFSFTRFLYSVLYGSYIGLATWLACTV TFGWTDINLIPFICVVALGITAGIYIIGQCGGQSRELSYIWMASFSSMFIMVRLAQTTVF RAIFLTAIVSTVIGNRSARLKKRRHTWKHFLFWSSLFLMLVCVILLGCSRKVADKQVTAT RPGTFRETISVGSLIRDRIFDAKKVHSFFEGNPIIEYHSKSDIKNKNGEKTLKNSSFWYQ VWSGELFDELTGAAHLTKIDWIELTTTFIVDVLRSEARVIDGSSTIEPFKWALWRNYLIH RFSLDPLISDDRLRTECKKWQTEEKSKKGNVDRDYNILAAKQGCSTFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF640R conjugate, 0.1mg/mL
BNC400322-100 1x 100 µL

CD3e (RIV9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL
BNC040031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details