Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Transmembrane protein 237B (tmem237b)

This Recombinant Danio rerio Transmembrane protein 237B (tmem237b) spans the amino acid sequence from region 1-413.

Product Specifications

Product Name Alternative

Transmembrane protein 237B, Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog B

UniProt

Q66IE4

Expression Region

1-413

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPEAKVSSSRRRDLPPIPQGQRRTPRALPSMPSQDTAEEMPAPKSRKKKAKRDAESVDE PDDGGMEMGGLASRRQSECPEPLTPEPLDNPPQRRKKKKKAQAIDAEGDQTDLVSNGDTL DQNTDEEVTRKPKKRKVKPKVTETQSNNELDVEDDDVITDPQSPIPQHSLFSAPQGPSQP VGKVFVEKSRRFQAADRVEQWKPSGPIEQSIMDIRSMWTTRDVSMRVHSGFRVIGLFSHG FLAGYAVWNIIVVYVLAGDQMSSLSNLLQQFHTLAYPAQSLLYLLLALSTVSAFDRVNLA KAPAAMRSLLRLSPVALASVFYFSALVLSLSQQMTSDRINLYKYSSYNTTLWPPGSESSI LYPWITVNLVVSLLVGLAWILMSTSPDIDNTEAFLMSMEMEYPNSEEKGNVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF594 conjugate, 0.1mg/mL
BNC941555-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1555R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL
BNC882063-100 1x 100 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2063), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (C86/1146), CF405S conjugate, 0.1mg/mL
BNC041146-100 1x 100 µL

CD86 (C86/1146), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL
BNC680779-500 1x 500 µL

CD30 (Ki-1/779), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details