Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Lipoteichoic acid synthase 1 (ltaS1)

This Recombinant Bacillus subtilis Lipoteichoic acid synthase 1 (ltaS1) spans the amino acid sequence from region 215-639.

Product Specifications

Product Name Alternative

Lipoteichoic acid synthase 1, Cleaved into the following 2 chains:, 1. Glycerol phosphate lipoteichoic acid synthase 1, 2. LTA synthase 1, EC= 3. 2.7.8.-, Polyglycerol phosphate synth

UniProt

Q797B3

Expression Region

215-639

Origin

Bacillus subtilis (strain 168)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SSDDLTSVENYTTSHYAKPNAEYFGSAKGKNIIKIHLESFQSFLIDYKLNGEEVTPFLNK LAHGGEDVTYFDNFFHQTGQGKTSDAELTMDNSIFGLPEGSAFVTKGENTYQSLPAILDQ KEGYTSAVLHGDYKSFWNRDQIYKHIGYDKFFDASTYDMSDENVINMGLKDKPFFTESIP KLESLKQPFYAHLITLTNHYPFNLDEKDASLKKATTGDNTVDSYFQTARYLDEALEQFFK ELKEAGLYDNSVIMIYGDHNGISENHNRAMKEILGKEITDYQNAQNQRVPLMIRVPGKKG GVNHTYGGEIDVMPTLLHLEGIDSQKYINFGTDLFSKDHDDTVAFRNGDFVTPKYTSVDN IIYDTKTGEKLKANEETKNLKTRVNQQLSLSDSVLYKDLLRFHKLNDFKAVDPSDYHYGK EKEIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF405S conjugate, 0.1mg/mL
BNC040851-500 1x 500 µL

HSP60 (LK1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL
BNC431050-500 1x 500 µL

CD3e (CRIS-7), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF647 conjugate, 0.1mg/mL
BNC470151-100 1x 100 µL

CD11a (Cris-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details