Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Gap junction alpha-8 protein (GJA8)

This Recombinant Human Gap junction alpha-8 protein (GJA8) spans the amino acid sequence from region 2-433.

Product Specifications

Product Name Alternative

Gap junction alpha-8 protein, Connexin-50, Cx50, Lens fiber protein MP70

UniProt

P48165

Expression Region

2-433

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GDWSFLGNILEEVNEHSTVIGRVWLTVLFIFRILILGTAAEFVWGDEQSDFVCNTQQPGC ENVCYDEAFPISHIRLWVLQIIFVSTPSLMYVGHAVHYVRMEEKRKSREAEELGQQAGTN GGPDQGSVKKSSGSKGTKKFRLEGTLLRTYICHIIFKTLFEVGFIVGHYFLYGFRILPLY RCSRWPCPNVVDCFVSRPTEKTIFILFMLSVASVSLFLNVMELGHLGLKGIRSALKRPVE QPLGEIPEKSLHSIAVSSIQKAKGYQLLEEEKIVSHYFPLTEVGMVETSPLPAKPFNQFE EKISTGPLGDLSRGYQETLPSYAQVGAQEVEGEGPPAEEGAEPEVGEKKEEAERLTTEEQ EKVAVPEGEKVETPGVDKEGEKEEPQSEKVSKQGLPAEKTPSLCPELTTDDARPLSRLSK ASSRARSDDLTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Las1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3243606 1.0 µg DNA

Las1l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
SDCBP Rabbit pAb
E2505360 100 µL

SDCBP Rabbit pAb

Sign In for Pricing
View Details
Rabbit anti-human Macrophage metalloelastase polyclonal Antibody
MBS7001770-01 0.05 mg

Rabbit anti-human Macrophage metalloelastase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Macrophage metalloelastase polyclonal Antibody
MBS7001770-02 0.1 mg

Rabbit anti-human Macrophage metalloelastase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Macrophage metalloelastase polyclonal Antibody
MBS7001770-03 5x 0.1 mg

Rabbit anti-human Macrophage metalloelastase polyclonal Antibody

Sign In for Pricing
View Details
Pcdhgb6 Mouse qPCR Primer Pair (NM_033578)
MP212176 200 Reactions

Pcdhgb6 Mouse qPCR Primer Pair (NM_033578)

Sign In for Pricing
View Details